DPCstruct | MC59331
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 176 ± 28 aa |
| Standard deviation of domain lengths | 28.16 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 22.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4VLP4 | 43-210 | SVLLLSFTVLYVLAVDRSNFKTCSQSGFCKRQRSTAQRPEYEVVPETVMRNASAVIAELRSRINTLRMVIVSLADSTIRVVIDEPEG… |
| A0A336LQR0 | 15-171 | LLGLILFVLLSTIVICVDKNNFKRCDQSSFCRRCRKVQPGSSPYSLVSSTLKTFKSYITLDLKNNENGHEFILKLEAVKGDKFHVEI… |
| A0A812YVG5 | 1-171 | None |
| A0A672URV7 | 1-187 | None |
| F6GWJ7 | 3-222 | None |
| A0A2J8AA32 | 14-173 | None |
| A0A6J1X8H2 | 6-186 | None |
| A0A183KY86 | 3-207 | None |
| A0A4Y9ZZ68 | 17-208 | None |
| A0A151NYI1 | 36-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.