DPCstruct | MC59327
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 117 ± 22 aa |
| Standard deviation of domain lengths | 22.35 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4VHM2 | 3-117 | AEDYEEDGIKWQCGTDDLSKIMSEASVEQTCPHLKAPINNCCVAHDDCYDKQLGQHFCDDKFCKCLDVTTKHNRSCNRGEAVLFCDL… |
| A0A1I8CQH3 | 45-136 | LADGHPYMCGAGPVSSWLSKVASSKCGNNDLNECCLKHDECYDSFINSQDECDQIFCDCIDNHYENFCKMWLKVTHCAVVKATGYFP… |
| A0A2H2HWT8 | 1-105 | None |
| A0A2H2IG42 | 18-167 | None |
| A0A2A6C597 | 21-150 | None |
| A0A2A6CC42 | 11-148 | None |
| A0A2G5T7L0 | 56-160 | None |
| A0A811L9T3 | 14-127 | None |
| A0A811LDR3 | 15-124 | None |
| A0A811LFY0 | 10-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.