DPCstruct | MC5932
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 89 ± 18 aa |
| Standard deviation of domain lengths | 17.66 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 65.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03030 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A804QH44 | 2-99 | LSTIATCLAIDAYGPISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVSRVAISTVDVLTPKVF… |
| A0A251UU02 | 1-90 | MYGIAVAALGMPSTIATGLAIHAYGPISDNAGGIAEMAVMSHRIHERTDALDAAGNTLLLSESLLFGFIFPLLWYYATTLYFRNYYQ… |
| A0A7J7LMU0 | 242-319 | None |
| A0A438G812 | 82-184 | None |
| A0A7J8XSA8 | 1-73 | None |
| A0A7J9MU83 | 1-89 | None |
| A0A3B8UQI1 | 38-161 | None |
| A0A0A9YZN2 | 15-137 | None |
| A0A6A2YV56 | 425-492 | None |
| A0A7V1EJK2 | 8-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.