DPCstruct | MC59318
Metacluster Properties and Pfam Annotations
| Number of structural domains | 962 |
|---|---|
| Mean domain length (aa) | 152 ± 25 aa |
| Standard deviation of domain lengths | 25.07 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 15.84 |
| Pfam Score | 67.18 |
| Assigned Pfam label(s) | CL0126- PF17659- CL0255- PF18212- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4DYU4 | 12-151 | QALFISPRKGESVKLGHETASFGKQQPYDVRGLIVRPFDEFLCSETGNYSHFKDNIALATRGNCSFFQKAWLAAEAGAKALIIGNNA… |
| S4RY53 | 28-199 | DDGLENVHPEAAKVPHWVRGRESATMIEPRNHSLAILGLGGSVGTPPEGTTADVLVVSSFDELRKLGTAAKGKIVVYNEPYVSYGET… |
| A0A068UUI8 | 1-131 | None |
| A0A7N2KM15 | 880-1005 | None |
| A0A2G8L5H6 | 89-231 | None |
| A0A453DN76 | 257-411 | None |
| A0A7S1ULS2 | 559-746 | None |
| A0A1B0BXD4 | 140-292 | None |
| A0A1R3KKZ4 | 2-120 | None |
| A0A803JSA5 | 21-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.