DPCstruct | MC59316
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 229 ± 28 aa |
| Standard deviation of domain lengths | 27.77 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 40.20 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0031- PF12368 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V9ZV72 | 59-262 | MYCTGGIRCEKASQFLRSKGVTDVHHLKGGIHRYLEKFPDGGFFQGKNFVFDKRVLMGPQSADVVGNCIECTTPYDSFNGVKVCSVC… |
| A0A7S4DT87 | 1-266 | GGIHQYLEEFGSDGYFKGKNFVFDQRVALGPKGCERVGQCALCKTSFDDFDPGTVCTVCRDPVLVCHSCRERDPYKEWYCKDHVPLR… |
| A0A7S2EFL2 | 231-488 | None |
| F0Y4X7 | 281-479 | None |
| A0A6A3KRX2 | 1-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.