DPCstruct | MC59312
Metacluster Properties and Pfam Annotations
| Number of structural domains | 146 |
|---|---|
| Mean domain length (aa) | 184 ± 44 aa |
| Standard deviation of domain lengths | 44.17 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 78.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 24.71 |
| Pfam Score | 98.50 |
| Assigned Pfam label(s) | CL0257- PF00956- CL0619- CL0071 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3ZCP7 | 40-233 | KFKLGAPTTPPQPEFWYTVLTNHPTISQLLNKRDLAVLRYLRDVRISLLKEGAKGFKVSFEFDPNNPYLLDRVLEKEYLLYPKISMG… |
| G8JML1 | 31-191 | KQRKVLLAPVYKKRSAVIEGIEGFWRIVLTQHGEFANYIRACDFRYVEAIRRVEVEWRWTERWEFAITIEFGEVKGKLRAQTVRKEF… |
| A0A4Y7JS83 | 76-225 | None |
| A0A5N4A6W3 | 36-171 | None |
| H0EIX9 | 15-291 | None |
| M2Q344 | 29-265 | None |
| A0A022R1L5 | 43-183 | None |
| A0A504X645 | 109-304 | None |
| A0A4S2MZ90 | 11-293 | None |
| M4CRW5 | 67-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.