DPCstruct | MC59309
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 72 ± 12 aa |
| Standard deviation of domain lengths | 11.73 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 40.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0758 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3T723 | 2-92 | ALLKVWTSPRLLNRCLQEVVAQRHFLAASTLHTATTQHNSNKTSIVRCSRQKYERMYPVLLIQPDGSTINIRYKKPKRILMMPVDIS… |
| A0A3S2NH67 | 22-71 | RYLNNNIASVTKIHRELYTRQYPTKVVLADGSSIDIRYHEPRKIIKLPLD |
| A0A3L8DGA1 | 267-318 | None |
| A0A131ZZJ6 | 1-77 | None |
| G1RVK4 | 47-113 | None |
| A0A0K0G1J5 | 25-96 | None |
| A0A1Y3BGN7 | 181-277 | None |
| A0A3B3I423 | 128-204 | None |
| A0A5B7JKA9 | 1-67 | None |
| A0A7J8FK07 | 188-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.