DPCstruct | MC59301
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 84 ± 5 aa |
| Standard deviation of domain lengths | 4.53 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 93.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 39.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P1ANS1 | 52-137 | QEIPQPTVAHRTSPTNIGLSLMANLTAWDFGYLPGGEVLQRVTLTLDSLDKMEHFRGHLFNWYDTRTLAPLNPRYVSSVDSGNMAG |
| A0A6V8LAR9 | 62-151 | SAYTSPTNIGGLMWSAVAARDIGTISRREASRVVGAALDGLAGLDRHDDSGMFYNWYDPHTGAVIRTWPEDGTPRTPFLSSVDNGWL… |
| A0A534UMY0 | 68-153 | None |
| A0A4R6QLR9 | 1049-1129 | None |
| A0A1H4GWG1 | 1-85 | None |
| A0A535AGH9 | 135-210 | None |
| A0A7U3FES6 | 994-1080 | None |
| A0A3D0XYS3 | 523-609 | None |
| A0A090QNB1 | 22-101 | None |
| A0A1H7A297 | 65-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.