DPCstruct | MC59300
Metacluster Properties and Pfam Annotations
| Number of structural domains | 87 |
|---|---|
| Mean domain length (aa) | 100 ± 15 aa |
| Standard deviation of domain lengths | 14.59 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0179 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4KUV5 | 5-101 | AMVLDAVKRCWASLWTARAIDYRARHHIASEDVSLAVVVQELVAADAAGILFTADPVTGSSNQVVINAAWGLARRSWGDWSRRIRLW… |
| A0A2P6PQM4 | 18-116 | EQAWLAIKKVWASKWNERAYFSTRKVKLDHDYLCMAVLVQEIINADYAFVIHTTNPSSGDSSEIYAEVVKGLGETLVGAYPGRALSF… |
| A0A7R9KK51 | 346-457 | None |
| A0A0G4HAY6 | 886-1009 | None |
| A0A7R9A9R6 | 3-71 | None |
| A0A0E0MLM1 | 609-728 | None |
| A0A1V1PBQ3 | 2-99 | None |
| A0A4Q7WDS9 | 150-230 | None |
| A0A1V5VQH6 | 2-75 | None |
| A0A2H5YUW4 | 1-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.