DPCstruct | MC59296
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 362 ± 63 aa |
| Standard deviation of domain lengths | 62.71 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 90.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10371- CL0344- PF01558 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4KPA1 | 6-496 | LLFLERFDVLKYSKPGGVFLLDSMYDVGEVWNFLPQEVQHALRDKHIRFYVIDAHKVAASVGMGGRINTIMQTCFFAISGILSREQS… |
| A0A5Q5GAY7 | 1-294 | MRFGDSPIHSAYQVNTPNFVACHVQAYLHMYDVTRGLRKNGFFLLNTIFDGEELVNFIPNKVKRYFAQNNITVYYINATKIAQEIGL… |
| A0A2M6YGI6 | 491-897 | None |
| A0A2A5SUM6 | 27-439 | None |
| A0A0X1KZW8 | 487-913 | None |
| T2JPL5 | 474-765 | None |
| A0A842SPC5 | 209-544 | None |
| A0A377E4C1 | 368-813 | None |
| T0CNN9 | 25-354 | None |
| R6HNS4 | 58-384 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.