DPCstruct | MC59295
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 70 ± 4 aa |
| Standard deviation of domain lengths | 3.77 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 70.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 63.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A818A6S6 | 1-76 | INSPVKEKIPIDYGKKMFVHFTCCSSMKTFPSKLHALWYEYFGQSPINEIIPVLGTRNVKNLQRRLTHTRSIDTDN |
| A0A815KIA8 | 24-91 | DSPYKERMRIDYDKVMFIHFTYCLSMKLFPLKFHTLWSKYFGESPINEIIPVLGVRNVKNLQRRLTNT |
| A0A815TXI5 | 147-215 | None |
| A0A815R5T7 | 67-144 | None |
| A0A817MPI0 | 160-227 | None |
| A0A819T1M0 | 36-104 | None |
| A0A822G6C1 | 71-136 | None |
| A0A816YFI1 | 79-144 | None |
| A0A819N1J8 | 1-66 | None |
| A0A820F3R4 | 152-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.