DPCstruct | MC59293
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 98 ± 14 aa |
| Standard deviation of domain lengths | 13.50 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 47.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817Z0Q5 | 7-113 | DDPYNNFKCWVYERIDYDKIHLSRSAGSFCGYNQTSQSYEAQDGVDLAITLAEAERIHDDCPIRYDDGRNVFVDLEEFNFYYAKSSI… |
| A0A177BBN6 | 773-859 | MEGMKSHLITYDLDDVVSKFRCWIYERTNWRTIVMSRSTRAVCNEIQTSKSRYPNEGASLLLKLHEAERINDECPQVYVDGKNPYES |
| A0A1J1J0T9 | 492-572 | None |
| A0A0X3NES3 | 200-312 | None |
| A0A816ABB5 | 1-76 | None |
| E9GYH2 | 396-470 | None |
| A0A5N5SLM2 | 158-245 | None |
| A0A815MAR5 | 992-1099 | None |
| Q5DBU6 | 8-111 | None |
| A0A818JN21 | 57-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.