DPCstruct | MC59290
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 66 ± 10 aa |
| Standard deviation of domain lengths | 9.87 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 92.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 72.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08082 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817WKP0 | 8-89 | TPAEHIRKIISDHGDMTNRKFRHDKRVYLDVLKYMPYAVLKLLENMPMPWEHTRNIRVIYHITGAITFVDEIPWIIEPVFIA |
| A0A7J8GF97 | 76-133 | MTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIP |
| U6LXD5 | 1-67 | None |
| B8C3V5 | 550-607 | None |
| A0A817XLM4 | 142-223 | None |
| D2V0Z6 | 130-198 | None |
| R0KPX4 | 19-70 | None |
| A0A6J5UGJ4 | 51-140 | None |
| A0A0G4KG05 | 98-154 | None |
| A0A816BRK2 | 1-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.