DPCstruct | MC5929
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 128 ± 23 aa |
| Standard deviation of domain lengths | 22.50 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 45.79 |
| Pfam Score | 93.55 |
| Assigned Pfam label(s) | PF00206- PF10415 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A251UI07 | 9-127 | NRLWGAQTQRSLQNSEIGGERERMHEPIIRSFGILKKCAAKVNMEYGLDPSIGKVLMEAAQEVAEGKLNDHFPLVVWQTGRGTQSNM… |
| A0A5P1EC12 | 3-116 | EPIIRAFGVLKKCAAKVNMEYGLDPAIGKAIIQAAEEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKFVHP… |
| A0A482X0U8 | 61-195 | None |
| A0A378VZ17 | 2-118 | None |
| A0A835TJT0 | 2-117 | None |
| A0A4R7AJ33 | 7-124 | None |
| B6A0Z2 | 19-154 | None |
| A0A844VWK8 | 2-115 | None |
| A0A2P5BJE1 | 469-601 | None |
| R9AA50 | 529-660 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.