DPCstruct | MC59285
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 134 ± 7 aa |
| Standard deviation of domain lengths | 7.44 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 74.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A037Z927 | 6-134 | VSIISTLMISFLVSTSASAKVASVLVKDTNTYYQYYYDDIRLAAEDKALGLDSQLYDEYVKRSSNVISLRDDLKGYVDYKAIKIAAE… |
| A0A4Q0VAR3 | 13-135 | TAAISTLIVTALTSGVLAKTTDVIVEMNGQNVKFNFEELNNSYEDKLLGLDAPLYDTFTKNQRIIALLDDKTGYVDYNAVATASEDA… |
| A0A386YJK1 | 11-152 | None |
| A0A072XFD2 | 15-144 | None |
| A0A7C6Y664 | 16-140 | None |
| A0A1E8EXZ3 | 1-142 | None |
| A0A3B8K6D7 | 20-154 | None |
| C6Q0U4 | 4-141 | None |
| A0A386YKB4 | 12-148 | None |
| A0A1V2YBA3 | 5-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.