DPCstruct | MC59284
Metacluster Properties and Pfam Annotations
| Number of structural domains | 107 |
|---|---|
| Mean domain length (aa) | 119 ± 17 aa |
| Standard deviation of domain lengths | 17.25 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03323 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A037Z5E4 | 6-134 | LDNKINKIYELLGNNSQIVSKKIYIGTGQSLDSAIIYVNGLADKDRIDRDILKPLMIYLQEDISNKESLEDYICKKYIYMSNTFVTS… |
| A0A351SR42 | 97-213 | AFCENYQKNLGIIKKRIKNKNLKIESVDRGVYTKTKLSILYLDDKVHKVELDKIKETLNRQKDKEVTDSYDLVKELETSKIFPTIFK… |
| A0A5C4SVY8 | 4-109 | None |
| A0A3B0BDB7 | 1-91 | None |
| R6Y759 | 80-214 | None |
| A0A2C1C624 | 5-153 | None |
| A0A7Y0L2F0 | 2-108 | None |
| S0FXJ1 | 117-271 | None |
| A0A2S8PMM5 | 99-217 | None |
| A0A286R814 | 3-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.