DPCstruct | MC59281
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 160 ± 24 aa |
| Standard deviation of domain lengths | 23.83 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 34.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0064 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A5GEV4 | 1-227 | MKIKKTIEKVPGGLMVVPLMFGALLNTIDQAHLPFIEAILKALGQSAGEDGHYSFLYIGGFSEALFKTGALTLIALFLFCAGSQMDL… |
| A0A0R1WFF1 | 13-161 | IPGGNIIIPMFIGACINSLFPSWLKIGGFTTPLAQGSGALVGAFLFVIGGSISFRSTGAAIKRGGTIILTKVIVAVALGLFVGKVLN… |
| E7NX06 | 13-162 | None |
| A0A7H4MHF9 | 2-148 | None |
| A0A847XT49 | 1-156 | None |
| A0A838C4L2 | 1-159 | None |
| A0A2E8Z6M1 | 3-160 | None |
| A0A0B7GSM9 | 1-133 | None |
| A0A841FCB6 | 1-166 | None |
| A0A7R8W0L1 | 226-381 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.