DPCstruct | MC59277
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 350 ± 68 aa |
| Standard deviation of domain lengths | 67.74 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 73.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 17.75 |
| Pfam Score | 81.88 |
| Assigned Pfam label(s) | PF11464- CL0229- PF05680 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V1ASR7 | 21-433 | VHRYNLESAVKEQHKAEEWKKQEKLIKKAKAEYARLHAPKEQPSTGASLSLKTLEDPNVDFGKVFESLIQKPPYTKEEYQEREKEIV… |
| Q59UQ8 | 111-439 | NKQKSTEVNSVDLTEQFKQKRLAKVEAQQLHRTRIQRNFIKLTDSLMNKSSVDGIANWSPNTKNCSICFVEFNLFIRRHHCRLCGSV… |
| A0A2A9NSL3 | 25-403 | None |
| A0A5B7DBR7 | 73-419 | None |
| M2RVU7 | 1-274 | None |
| B0EF00 | 14-264 | None |
| H3ALD8 | 77-514 | None |
| A0A0N4W1I5 | 59-356 | None |
| A0A0G4M0L0 | 373-718 | None |
| A0A0B1TDY6 | 8-388 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.