DPCstruct | MC59275
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 172 ± 33 aa |
| Standard deviation of domain lengths | 33.23 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.43 |
| Pfam Score | 59.13 |
| Assigned Pfam label(s) | PF08223- CL0728- CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A522SKY8 | 1-135 | MLPQAEDHAEFFAQLADAVRKQNGSATVFLVQAMSPTEQETLISRFQADRAREYDEFAERSRGFLDEIAKETGLQKFTFAELEEIED… |
| A0A1S2GNX5 | 14-199 | ARASDPWLLVSFSVPEAQRGQRHKIRSGLSRMGFGVVSAGLCVAPGHVYNEALEYLQDNDLLQFVDFFHANHGGPEELRTKVAQWWD… |
| A0A7X1U0U1 | 3-149 | None |
| E4THB5 | 3-131 | None |
| A0A7C6EIM1 | 14-173 | None |
| A0A2N6RHE7 | 7-146 | None |
| A0A1G3MZU8 | 25-264 | None |
| A0A853DST4 | 48-257 | None |
| A0A843T585 | 2-159 | None |
| A0A840WWW0 | 26-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.