DPCstruct | MC59274
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 176 ± 27 aa |
| Standard deviation of domain lengths | 27.44 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 29.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0222- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P2NHB4 | 22-180 | LEILSDRHSADEFALMWANQQELAILHTKLPIVSRYRISYITARLFVGIGRGEVLPSKDTRHLLLQTWLEPLINDYSWLLHGSRSFD… |
| A0A287DW70 | 65-236 | LYSACNGCLCLLREQFVRAAGGDQSEVPQIARQADNLHWVLDILVERQIAEDFLRTWAIQNELAEMHGKVPAIHRYEVSRVTARLFV… |
| A0A6J0NUS4 | 140-311 | None |
| A0A835LIR3 | 2-116 | None |
| A0A6J0P316 | 87-249 | None |
| A0A834SXS9 | 142-346 | None |
| A0A6V7PIB1 | 24-232 | None |
| A0A6A2YWU0 | 292-483 | None |
| A0A397XZG1 | 145-304 | None |
| A0A061FV46 | 3-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.