DPCstruct | MC5927
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 105 ± 13 aa |
| Standard deviation of domain lengths | 13.02 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 45.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A251UB47 | 1-94 | MEGTSSPSTDAGPIPHLGDTISKSTEGPASPGRFPYEPDELNGGDSVLSIQRRLLSLKPFPSAEEIDFARTQAEDLFEVKVQIIQRM… |
| A0A151UHE2 | 16-110 | GSSESESAGTSSSVNQQGARPAPAQNEVAPPVVPYPYPENEIIGGDSVEAIERRLLGRFPSPSAHDIQMARIQAEDLFEVKVDIIRR… |
| A0A6A4NCC5 | 103-186 | None |
| A0A6A5L6P5 | 188-302 | None |
| A0A7T3UT54 | 38-136 | None |
| A0A7G7LQI3 | 5-103 | None |
| A0A699IS65 | 67-185 | None |
| G2XLQ9 | 117-251 | None |
| A0A3S3N320 | 105-227 | None |
| M1DLI2 | 87-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.