DPCstruct | MC59269
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 220 ± 60 aa |
| Standard deviation of domain lengths | 59.50 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 91.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.00 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | PF17479- PF11258 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V5C209 | 339-594 | VFELPVEGITRLIAVYHQSDAEVVGPVRSGRPTDATLVKPLGGPLQISGAQPWVKDGFDDADLLWIDDLGITTYRTDARKRPHNLLS… |
| A0A850AZG5 | 140-355 | NSCFIFASASPEILPMLPQCYLVPHDEASGGAMLTIEKMISLAEENRESNSDEFNYASNAFSETPPPGGLPANIIKSYAARLNQAAW… |
| A0A6N7WBS6 | 26-280 | None |
| A0A535T3G1 | 1-101 | None |
| A0A2E0RU76 | 438-683 | None |
| A0A0G0SZ33 | 42-137 | None |
| A0A6L5ETL0 | 85-309 | None |
| A0A523E0K0 | 110-358 | None |
| A0A7W1TP48 | 20-211 | None |
| A0A2H2J7G7 | 21-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.