DPCstruct | MC59268
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 517 ± 64 aa |
| Standard deviation of domain lengths | 63.53 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.40 |
| Mean intra-cluster sequence similarity (%) | 13.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0181 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5F344 | 6-588 | LKLLRLRARLAWNTFKHRSLGQKIGYGVAFLGLLTFAGIIIFFSWGLLQFLTNPRILRELEAAGLNLNFGEMLVQLPVLFSIGAFVV… |
| A0A1F2TUH4 | 5-585 | ALKELRVLMPPAGLIVGAAILAMVGGHSHTRAIFGLAVRVLLLSFFVGMAMLAATSFGSEFQQRTLVLLLSQPIARTRVWFEKWAAL… |
| A0A1R3UW29 | 11-512 | None |
| A0A521GFY9 | 3-583 | None |
| A0A521ZQ92 | 1-525 | None |
| A0A536RHD1 | 3-534 | None |
| A0A4Q6GXZ3 | 7-592 | None |
| A0A2R6D873 | 4-536 | None |
| A0A376E0L3 | 321-833 | None |
| Q01UT4 | 526-953 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.