DPCstruct | MC5926
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 67 ± 3 aa |
| Standard deviation of domain lengths | 2.66 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 66.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 77.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V4WGD3 | 110-178 | MKKGLHPQMQWISYVTQSGRLMHIMMTKIHNVGKVYHFRARRQMAQSIGQVAKFRRRYEQQEDAENNKK |
| A0A251U7S7 | 1-63 | MQWISYVTQSGRLIHVMMTKIHETGKVYHFKARKQMAQSVGQVAKFKRRYGQAEEEEKDNEAK |
| A0A6P6SGM2 | 65-133 | None |
| A0A803QCB5 | 1-62 | None |
| A0A438JVT6 | 130-197 | None |
| A0A6V7QNF5 | 6-72 | None |
| A0A5N6NWG8 | 1-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.