DPCstruct | MC59256
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 149 ± 23 aa |
| Standard deviation of domain lengths | 22.83 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 91.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 34.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3E1EB09 | 26-185 | CQAATSKRLTALADDFAHADDLRRLAARIKQHTLDHLDTYLEAATARLEEQGVKVHFASEAEEARSLIHQILAERGAKRIVKAKSMV… |
| A0A535R9B8 | 30-177 | ERLEHALSDDNMHRALERFAPSWLASRKDVFAIEEDDYGSDYSFAHMRSTLRQAKDYAIEHQPELIARFKAQAEAAGAIIYEARTAE… |
| A0A354TC76 | 1-192 | None |
| A0A2V6TKX0 | 31-165 | None |
| A0A5C8NX30 | 9-133 | None |
| A0A136LDH1 | 1-143 | None |
| A0A6G3V1W6 | 2-97 | None |
| K6P2U4 | 36-225 | None |
| A0A401YWR6 | 298-479 | None |
| A0A0P0M3B1 | 10-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.