DPCstruct | MC59253
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 157 ± 20 aa |
| Standard deviation of domain lengths | 19.71 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 28.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D7AAS7 | 12-158 | TAEVEAWESDHSQPNPYEPKLKPLTQRDVRLRLAEEEKAEATRAAALGHIRSKLTAQKLLLQGLELEELQRKLRRDVHALGQHATSL… |
| A0A401G858 | 102-254 | VMQEDRDTWRTVVESWEKDPSKPNPFVVTRPAMTQASVHLQLTNEEAVELENSEQCGMLCDLVSPSVMIMVGIELQEQQYHLRQDTE… |
| A0A0D7AMJ2 | 225-403 | None |
| A0A284S5H6 | 1-125 | None |
| A0A067PGY8 | 25-178 | None |
| A0A0D0CU99 | 1-131 | None |
| A0A284QWY5 | 2-123 | None |
| A0A0C9UKY9 | 29-215 | None |
| A0A0C2ZUS1 | 170-326 | None |
| A0A401GDV2 | 31-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.