DPCstruct | MC5925
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 56 ± 3 aa |
| Standard deviation of domain lengths | 3.11 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 77.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 70.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0267 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J5VD72 | 1-56 | MGIPPVRPPRITKYLKPYVLKMHFTNKYVTAQVIHTPTATVASSASSQEKALRESM |
| A0A251U7E9 | 1-56 | MVIPSPVKAQRITNFLKPYLLKMHFSNKFVSAQVIHAPTATVAAAASSQEKVLREA |
| A0A498IJR9 | 1-56 | None |
| A0A3N7F2W6 | 1-56 | None |
| A0A7J0ERQ4 | 1-57 | None |
| A0A3B6C4L2 | 1-57 | None |
| A0A3S3NAT0 | 50-107 | None |
| A0A453FWT6 | 1-57 | None |
| A0A835K9I9 | 28-82 | None |
| A0A453H6T4 | 1-46 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.