DPCstruct | MC59247
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 176 ± 14 aa |
| Standard deviation of domain lengths | 14.24 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 36.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L0S9G4 | 1-196 | MVSPAPPPSRLLPLVVAAAALLVLAIAAAPAHASACPGTGKQCEKWAPCCAQNYCVAQPWGCMTSEGCNADASFAKSSCTPRPMCKS… |
| C0NBI6 | 244-395 | SAPCCSQYGECGLGAYCLGGCDPKYSFSLESCVPAPICKSMEYKFENLDSVVPRTKYLGDADKAGWVSSGKPLTTNGDLVMTMAPDT… |
| A0A4P9Y7T0 | 1-181 | None |
| A0A2T4CJX4 | 1-183 | None |
| A0A0G4MUZ9 | 259-445 | None |
| A0A6V8HD31 | 1-163 | None |
| A0A319DXI5 | 1-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.