DPCstruct | MC59243
Metacluster Properties and Pfam Annotations
| Number of structural domains | 363 |
|---|---|
| Mean domain length (aa) | 161 ± 30 aa |
| Standard deviation of domain lengths | 29.68 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 12.94 |
| Pfam Score | 57.98 |
| Assigned Pfam label(s) | PF14736- CL0663 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0U5CGP0 | 11-171 | KELHEDGERVLIVPMGGVEFVAFNTKPAIGTIGLNSCSVVIIASQHGAILAHIPPRLHLTSDDLHEGDRNVRRMMALVKAEHDRYKP… |
| A0A1H2IA19 | 50-216 | TVVDGPVTEPVPATDALVTTTPGLALAVLSADCVPVLLSDDEAGVIAGVHAGRVGARIGIVRETLKVMVELGARISSIGAFLGPAAS… |
| A0A318YFI2 | 467-675 | None |
| A0A0W0Z9C3 | 81-244 | None |
| H9G882 | 108-261 | None |
| A0A517T2T4 | 26-157 | None |
| A0A2V1DGM9 | 277-475 | None |
| A0A7C2CNM4 | 41-199 | None |
| A0A178EGC6 | 345-545 | None |
| A0A518HVF6 | 10-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.