DPCstruct | MC59239
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 168 ± 22 aa |
| Standard deviation of domain lengths | 22.46 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18934 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661SCM7 | 120-245 | DEEVWIRQLHQLSDADHLNPLLSGYACAILLERKLISDENLAREVSRRLSPGIEADLGAGWFEGLSKRNRYALLARLPLWEQLAGYV… |
| A0A0P9D0Y7 | 1-165 | MAAWQAALRRVCDLRGAHGLVAGRACRILLDTGALGAEEGARRLSLALSPGNAPPAAAAWLEGMLRGSGALLVHDATLWQLIDGWLR… |
| A0A6I1YKG1 | 783-947 | None |
| A0A6B2E1N0 | 1-184 | None |
| A0A1Y4D1U6 | 82-213 | None |
| Q08NF1 | 49-236 | None |
| A0A6J7AT58 | 156-337 | None |
| A0A7K2Q7Q7 | 15-203 | None |
| A0A509EF06 | 254-434 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.