DPCstruct | MC5923
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 164 ± 14 aa |
| Standard deviation of domain lengths | 14.22 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 48.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0N997 | 3-163 | PPRGILSSLWQFILFIPYFTGLLLLGVLKGIVFCPIICIIVAIGNSAIILGLLPAHAFWTLYSITSAKQLGPILKLFLCLCLPLGII… |
| A0A251U4B9 | 1-159 | MEPPRGFWKSVGQFFLFLPYFVGLLLLGFIKGIIFAPIICVIMTIGNSAVVIALWPAHVVWSYFCILSAKRLGPVMKVVVCLLFTPA… |
| A0A6S7NEC5 | 5-167 | None |
| A0A446MG67 | 1-165 | None |
| A0A2G5EK80 | 1-165 | None |
| A0A287WAU5 | 2-166 | None |
| A0A067JJI9 | 1-165 | None |
| A0A834ZJX4 | 557-732 | None |
| A0A2J6JY95 | 1-165 | None |
| A0A4S4CZH3 | 1-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.