DPCstruct | MC59224
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 185 ± 13 aa |
| Standard deviation of domain lengths | 13.04 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 26.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A417MW11 | 20-199 | FLIVLALALSNLAKGDIRERSQDVEDYRKWSVQEKYTQFLIFPEKIPAEAEEVEYYYQYESGWGRPMSQIYLSYRLDEDTYAKEQER… |
| A0A1H7W5W3 | 3-168 | PIEEYDDITHYNEYMSFSRNEAPFKDEENKWTKLGMDEHIWPYKITDDMNVADFKMVYYNPWDAQYLGYLVVDYSADDYAEEVKRLR… |
| A0A6L5YP20 | 264-465 | None |
| A0A3E2NBL1 | 12-189 | None |
| A0A355W2J8 | 3-192 | None |
| A0A1I7I8B9 | 29-236 | None |
| A0A1G5S204 | 284-465 | None |
| A0A1H9YI93 | 176-373 | None |
| A0A3D4QVA0 | 89-259 | None |
| A0A4V2R292 | 10-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.