DPCstruct | MC59222
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 90 ± 11 aa |
| Standard deviation of domain lengths | 11.35 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E3Z7V2 | 2-88 | IVGGILLYGALNYHILRAKDGFHLIPKTSARLGSTYVDIRNFTVTDMANHADIVEVIILSDKKELMRDATSGAIENGINRFLDRNSG |
| A0A517QSG4 | 12-86 | FLGSVVSLLAMQVHVINTNDGLIVLPRSNRPPIRSTYVDVRKWSLSMWRQHPEVAEAAVKGGRPDLLADGALNSI |
| A0A356AHH2 | 55-142 | None |
| A0A3N5S108 | 1-119 | None |
| A0A518ATE4 | 12-95 | None |
| A0A2E0SIU5 | 15-104 | None |
| A0A3B8ZK71 | 37-124 | None |
| A0A2E7D9N4 | 91-185 | None |
| A0A142Y0R9 | 12-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.