DPCstruct | MC5922
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 91 ± 9 aa |
| Standard deviation of domain lengths | 9.05 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 44.67 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | PF05527- PF15803 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J0ETD9 | 1-88 | MSVYGGDSWAREAQYRKRRVDDLVVEGLDASSYKKLSGGKYACLVCPHNPVFDTPLVLSMHIKGSCHCAAESKLKKKQFVIQDEINKR |
| A0A251U438 | 5-89 | INERVWGDSWGREAHYRKRRVDDLLLDAAGDQSSSYRKLSSGKYACLLCPHTPVFDTPVILSMHMKSRRHLAAESRFKQNEKKDK |
| A0A1R3HUT0 | 157-248 | None |
| A0A674IIM0 | 1-99 | None |
| A0A0P0XGY0 | 24-133 | None |
| A7RPM3 | 1-73 | None |
| A0A3B4AGH3 | 2-94 | None |
| A0A6I9N8G2 | 2-98 | None |
| A0A672UJS0 | 1-98 | None |
| A0A1D6KLD9 | 1-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.