DPCstruct | MC59219
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 142 ± 14 aa |
| Standard deviation of domain lengths | 14.41 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D6SMZ5 | 1-153 | MGEFQEVVKSIVALLNELADTGGVTSQKIPEIIGSTLEENRVIEGDARNAFNCYPGIPGHGCKDLAFFVSLTSPGFYKGRGHLNCGQ… |
| A0A7V6NNH3 | 6-146 | DELLYVLLDKLSELGLADFGELILPLLERIAEKGTKGKCPNGEEIGIDHYINFIPSRIKGMCCDRLVVVCFDGDSLDERLREMVYHS… |
| A0A1T5E9X2 | 45-169 | None |
| G7V5P9 | 35-185 | None |
| A0A1X7JJD3 | 16-166 | None |
| A0A1H6GFV7 | 38-171 | None |
| A0A1F9ZRH5 | 248-405 | None |
| A0A6M0JS72 | 225-378 | None |
| A0A7C2VI87 | 9-154 | None |
| A0A3B9PDY4 | 134-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.