DPCstruct | MC59216
Metacluster Properties and Pfam Annotations
| Number of structural domains | 73 |
|---|---|
| Mean domain length (aa) | 278 ± 61 aa |
| Standard deviation of domain lengths | 60.65 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 81.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 19.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3SBG0 | 15-269 | LEVPNRGKLPTYPSEALNNIWSIKSTPPDSFASDTQIFPIEGTQKVSTCPNCNGAGEISRVCWSCGGSGSRVCSSCAGSGSIVRDEY… |
| A0A0S7G575 | 16-242 | QPAPTPWEVQTKTPELFTKHTEEIRVPYTSNVKECNACHAEGTVSCKDCEAKGYKQCTQCNGSGKNEGENCTHCNGTGKDRCSKCSG… |
| A0A842TKK9 | 473-733 | None |
| A0A665TSG9 | 29-274 | None |
| A0A177VKF6 | 137-413 | None |
| A0A3B9KU61 | 40-403 | None |
| A0A267FVY7 | 72-384 | None |
| G0JM55 | 10-335 | None |
| A0A6J2VSF9 | 12-227 | None |
| A0A7X6X0M4 | 34-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.