DPCstruct | MC59215
Metacluster Properties and Pfam Annotations
| Number of structural domains | 207 |
|---|---|
| Mean domain length (aa) | 92 ± 14 aa |
| Standard deviation of domain lengths | 14.34 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.69 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 21.32 |
| Pfam Score | 74.92 |
| Assigned Pfam label(s) | CL0072- PF04294- CL0037- PF12587- CL0158 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3S4P7 | 60-153 | VLRTRKDAVLLTVVTKEKRKRQVVVPAPVQMRPSPRMYKGKQLVLQPGRPGLKEVTYVRVCENGIPVRTEQEQTVLLRRPRARVVVI… |
| A0A6I6ELV4 | 2-75 | KVELISQTLERKESPVKYISDMGMQPGSTSIVQKGHTGYKSKLIKKVYENGKLIKTETVSQDKYLAAPTIIRQG |
| A0A7X2QP27 | 19-110 | None |
| K1AJI1 | 14-97 | None |
| A0A139PJJ3 | 948-1043 | None |
| A0A1Q6R0W6 | 1-88 | None |
| A0A389M5Z7 | 153-235 | None |
| A0A2N2CIJ2 | 36-132 | None |
| A0A7X2QQB3 | 69-163 | None |
| A0A7X9CE64 | 2-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.