DPCstruct | MC59211
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 196 ± 31 aa |
| Standard deviation of domain lengths | 31.02 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09347 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E4PG39 | 2-184 | AVRLKKGNTLELRNESGSQVCDFWAFKEDNLHESLSMEHCRTHLGRNSIREQDELVTNWRRPVLKVLSDTSPGVHDMLIASCDLNRY… |
| A0A2U9PCF8 | 10-201 | SIDIPAGEGRAVHVDAGQRVKIIDVEGRQVGDVFAFARGDVREYHSASHTRAHVNRLFPAVGEQFVTSLRRPILTLVEDSSPGRHDM… |
| A0A2S6TEF3 | 10-177 | None |
| A0A2K9CSN5 | 12-216 | None |
| A0A2S9D6P6 | 581-787 | None |
| A0A3M7MCF4 | 364-545 | None |
| A0A3M7M2B5 | 672-923 | None |
| A0A3M3FR74 | 289-502 | None |
| A0A420MMY9 | 501-689 | None |
| A0A2V1DFG7 | 639-815 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.