DPCstruct | MC5921
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 280 ± 56 aa |
| Standard deviation of domain lengths | 55.57 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 75.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 17.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2WER8 | 20-323 | GLPLPLPSPPAMNHLNAPYQGQGAGAHAMVPMLHQAPGARDTEANRKESLYLSHLEVRARMPLMMNSITGQYQGFVRSYRDYDVVNC… |
| A0A6A6WYW1 | 11-210 | AQPYQFDDSGVPKLAFSNDQAAAHAYRRRSTMPPQLDPESDPTIVEVREAQERWISDMVQAVFNHDGVPEAVNLPAYTMFMHGSRTV… |
| R1EFC7 | 348-629 | None |
| A0A3M7M1X7 | 112-497 | None |
| A0A6A5ZMD9 | 37-272 | None |
| A0A6A6Z8U0 | 188-467 | None |
| A0A6A5ZJ90 | 7-202 | None |
| A0A6G1IGS6 | 1-196 | None |
| A0A2A9PMA9 | 68-421 | None |
| A0A6A5QRI1 | 1-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.