DPCstruct | MC59207
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 84 ± 13 aa |
| Standard deviation of domain lengths | 12.53 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H5K8Y9 | 61-137 | PDPPPPAPPAPKLPDHPAYEQIMAVFAASDAPLRARQVCEAMDLEVAPNNINNTRLKLKRLTERGILVETEQGLFAQ |
| A0A1L6PVG0 | 3-78 | LVPDRVAGMGLEALTSEFQRIMGIVAGADGPVMAKDVAMALGRELTPGKVEPVRGQLRKLADRGWLNRTGSGRYLP |
| A0A2G7BIL6 | 1-89 | None |
| A0A421LCQ3 | 63-179 | None |
| A0A1C6LSJ7 | 111-194 | None |
| A0A4U0S828 | 380-488 | None |
| A0A561F1Z6 | 1-76 | None |
| A0A7K2H1D6 | 73-159 | None |
| A0A7X0U3I4 | 43-128 | None |
| A0A2U3A8X6 | 8-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.