DPCstruct | MC59204
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 600 ± 117 aa |
| Standard deviation of domain lengths | 116.74 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 21.76 |
| Pfam Score | 79.70 |
| Assigned Pfam label(s) | CL0039- PF17162- CL0126- PF17148 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F3V4A7 | 41-705 | GQEWYLAETITKISAGSPSLVAHHANERIVKFKLTKKHLIMYHVDTNKHDTQVLNEETGSVVGGEILSRFPIAAHFDMVFRKDPYGK… |
| D4VSR3 | 50-639 | ELPLNLLEKDMLLGSTISETTDNRFGSVGEKPYAPLHITFIKTDSLISLCEVSDDYMSHDSNLQQRISESTRPAILKNFNIKAYSPD… |
| A0A2D6JJG4 | 65-657 | None |
| A0A5D6XUH7 | 463-1161 | None |
| A0A812VIH5 | 127-906 | None |
| A0A1Q9E9F9 | 5-448 | None |
| A0A2V7Y8Y7 | 24-513 | None |
| B8CRQ5 | 1-544 | None |
| A0A812KIT6 | 70-747 | None |
| H3HAW0 | 12-594 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.