DPCstruct | MC59202
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 134 ± 28 aa |
| Standard deviation of domain lengths | 28.09 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 86.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 18.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18974 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A368A2K9 | 47-188 | ETNVRSTSYFIGKNTQRCWKCKERTNVYGFYLPGGSEVFDEKREIWKERWKSLCLSYVIYLVPSVAEGIRIFSRGHYYISFSKTVEQ… |
| A0A662VYL5 | 49-154 | PKEVEIELWMWYRKCWKCGKETPVLWTSPHSVVGEFNVDPVSFEELPKKISEIYPFFKLTFSKTMGENVYGNVCINCGAYQGNWFVW… |
| A0A2A5B223 | 2-103 | None |
| A0A2T1IAC3 | 1-127 | None |
| A0A7C6XUI4 | 70-215 | None |
| A0A2G1DM38 | 119-242 | None |
| A0A2S5RF40 | 46-158 | None |
| A0A2P7B373 | 25-165 | None |
| D0III3 | 54-190 | None |
| A0A259QPI8 | 61-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.