DPCstruct | MC592
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 105 ± 10 aa |
| Standard deviation of domain lengths | 10.33 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10270 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A665WS90 | 2-107 | ASSFWKGVVGVGLFALAHAAFSAAQHRSYLRLTEKENETLPIDIVLQTLLSFVMTCYGIVHIAGEFKDMDASSELKNKTFDTLRNHP… |
| A0A1Y2F0Z2 | 1-97 | MLKYAICCFGILLLSHASYSALQQIRIQRNQENGNQSLPYDIIAECMASIVVMLIGLTISTKNFENISIEETNKQNKMDSINTHSDF… |
| A0A183E7H4 | 1-102 | None |
| G0MV74 | 2-104 | None |
| A0A7J6Z5T3 | 101-224 | None |
| A0A7S2SS50 | 8-121 | None |
| A0A445CR86 | 41-152 | None |
| M7Z2U1 | 1-79 | None |
| A0A078I5C2 | 50-163 | None |
| A0A834JRI4 | 43-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.