DPCstruct | MC59199
Metacluster Properties and Pfam Annotations
| Number of structural domains | 129 |
|---|---|
| Mean domain length (aa) | 138 ± 25 aa |
| Standard deviation of domain lengths | 24.90 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 16.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0348 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N1XPA3 | 2-140 | RDVAGIMLSAVEDNFEAQGRAKWKDLQQSTKDSRAKQGTWPGKILQRSGHLASSIVTRHSAYEAAVGTNVAYAAIHQFGGRTKAHVI… |
| A0A662VK77 | 1-138 | MTVKDVNNIPKLLNDLDGILDRVADKVGAYLESKLVEMIDKQWGGWQPLKPATIKRKRSTKAWVDTGELRSLITHIVEGNIPKIVKV… |
| A0A8B6S3D0 | 1-169 | None |
| H2CL58 | 1-158 | None |
| A0A3M0X1L7 | 8-138 | None |
| A0A7W1N1Q5 | 2-115 | None |
| A0A1V5GYN4 | 1-175 | None |
| C4I4Y7 | 39-173 | None |
| A0A497BAQ8 | 26-176 | None |
| B1HH91 | 139-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.