DPCstruct | MC59190
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 64 ± 9 aa |
| Standard deviation of domain lengths | 8.86 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 57.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00571 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S4RHF2 | 41-113 | LQVKKAFFALVANGVRAAPLWDNHRQAFVGMLTITDFINILHRYYKSPLVQIYELEEHKIETWRELYLQDSFK |
| A0A4W3JLT2 | 1-55 | MVANGVRAAPLWDNVRQCFVGMLTITDFINILHKYYTSPMVQIYELEEHKIETWR |
| A0A6I8NXT0 | 202-267 | None |
| A0A267G714 | 502-565 | None |
| B7Q3C0 | 72-140 | None |
| A0A3P7NCC2 | 1-82 | None |
| A0A7J7K0C5 | 328-383 | None |
| A0A6B9VM65 | 292-347 | None |
| A0A2H1BWC3 | 89-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.