DPCstruct | MC59189
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 333 ± 49 aa |
| Standard deviation of domain lengths | 48.60 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.45 |
| Pfam Score | 97.22 |
| Assigned Pfam label(s) | PF07962- PF10266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W3IZR0 | 1-352 | MVVGRLRSDDIYNQVSAYPLPEHRSTALATQAGMLYVILYFEPSILHTQQAKMREIVDKYFPDNWVISIYMGITVNLIEAWEPYKAA… |
| A0A812RIG0 | 65-423 | FARFPLHEDALRLVIGKLQTGDVYEASRHYPLPEHRSHGLSAQAGMLYVSLFFQVKTLESDAIAMREIVDRHFGDVWVIAYALGYTA… |
| D3BMK3 | 2-277 | None |
| K3YCJ5 | 234-568 | None |
| A0A3P7MAR1 | 3-340 | None |
| A0A158QPT0 | 2-222 | None |
| T1KG62 | 209-621 | None |
| A0A6V7VKZ5 | 206-524 | None |
| A0A814TI81 | 97-489 | None |
| A0A402EAL9 | 10-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.