DPCstruct | MC59188
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 133 ± 25 aa |
| Standard deviation of domain lengths | 25.27 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 42.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W3IZE8 | 2-124 | SERKEGWERQAKELLKHFEQLLMVRQSMFCSPFIHHQHRLEIEKDILSKATTDPIAKEIGMEEDLKEIFQRDKHCAEKWNSDGRKNG… |
| A0A3B4T235 | 5-146 | KMYQSKKKEVEELEVTVRIYLWKIYQSVMKVEKLEGAVKIHQDYIEQDQQEKLTEVENLLVERQHVFCSYRKLYSKRQQLEDQILQK… |
| A0A4W3J275 | 1-95 | None |
| E2QWH7 | 365-467 | None |
| A0A6P6RJV0 | 87-189 | None |
| V9L5J5 | 59-159 | None |
| S4RQ94 | 122-267 | None |
| A0A3B1IWL5 | 32-166 | None |
| A0A672LEC0 | 34-191 | None |
| A0A7J6C0N4 | 104-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.