DPCstruct | MC59187
Metacluster Properties and Pfam Annotations
| Number of structural domains | 280 |
|---|---|
| Mean domain length (aa) | 78 ± 15 aa |
| Standard deviation of domain lengths | 14.63 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.68 |
| Pfam Score | 99.68 |
| Assigned Pfam label(s) | CL0451- PF19548 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E7F8B1 | 101-159 | SKVCLFRGKTYRVLEEFRLSPCERCRCEVNKEVYCTISGCPALHCVNPVYEPNHCCPVC |
| A0A4W3IXZ8 | 10-83 | FLLLVIAQVPLTGAQVQSCTQNGVTHNDKDVWKSDSCVLCVCDNGLVVCDEIICRTVHCFNAEIPLGECCPICP |
| A0A821VAE2 | 2-87 | None |
| A0A6I9YEM9 | 2-105 | None |
| A0A7M5VH88 | 424-510 | None |
| A0A3S1BHX9 | 596-679 | None |
| A0A2G8L662 | 238-304 | None |
| A0A6P8HVB2 | 766-828 | None |
| A0A182FH47 | 32-103 | None |
| A0A5N5TME6 | 112-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.