DPCstruct | MC59181
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 233 ± 30 aa |
| Standard deviation of domain lengths | 29.95 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 32.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J5ET28 | 252-483 | PEAHCDDADFFDAPDYPQTREAATATLQKCVMHLRRRMREGIRDAKALLSHENQIVVGEVDLLGGSCTFGPISVSGRAKCNVLEGLG… |
| A0A7K0S2Y0 | 25-221 | LSYRCEGVVEVAHKMLNTSNRVDISEPDYGNKAGGCTFNGDYGRIKCLMLQQFGYALHAVEDFYSHSNYTDKASSPFSILNPPGLEM… |
| A0A7K0RGE2 | 97-366 | None |
| A0A6J7AK80 | 2-224 | None |
| A0A0M9CPI0 | 1-188 | None |
| A0A6A6JF93 | 102-357 | None |
| J6ENK2 | 79-342 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.