DPCstruct | MC5918
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 257 ± 39 aa |
| Standard deviation of domain lengths | 38.79 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 19.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W9Q3M1 | 210-532 | WLKIAGLFQSYMDEPETSMVLRMFDYHRECDYGDEYIRIFQQRFLPNFYNGPLIHRLEAFRLGSFHCQTSTTLSSLIARDKKITSFD… |
| A0A1Y2W5U3 | 100-361 | DICDCYAGVSSVETYQALLSYQCPQHLSTSLDSRVQSANRAIYQTGHLEVVKLILEPDWSNNSEAIFSNTTSGIIPAIARRLCFSAA… |
| M7UAI7 | 169-422 | None |
| A0A161VJN8 | 385-646 | None |
| A0A194XKN0 | 73-350 | None |
| A0A4Z1ISM4 | 83-336 | None |
| A0A4Z1HZI1 | 7-224 | None |
| W9VMY6 | 22-251 | None |
| A0A2S7YES9 | 3-237 | None |
| A0A3M7FLZ2 | 181-395 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.